PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016512818.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 383aa    MW: 44014.1 Da    PI: 8.7252
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016512818.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.24e-5011271128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s
  XP_016512818.1   1 MFPGFRFCPTDEELISYYLKKKVEGSDKCV-EVISEVEIWKHEPWDLPdKSIVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS 94 
                     579************************777.99***************778888999************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +g+k+tLvf+ grapkg++t+W+mhey +
  XP_016512818.1  95 -GSNMIGTKRTLVFHMGRAPKGQRTQWIMHEYCM 127
                     .99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.7871145IPR003441NAC domain
SuperFamilySSF1019411.7E-552144IPR003441NAC domain
PfamPF023651.1E-263126IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MFPGFRFCPT DEELISYYLK KKVEGSDKCV EVISEVEIWK HEPWDLPDKS IVQSDNEWFF  60
FSPRGRKYPN GSQSKRATES GYWKATGKER NVKSGSNMIG TKRTLVFHMG RAPKGQRTQW  120
IMHEYCMTGN TYYQDSVVVC RLRKNNEFHL NDTHGNRRNH LANDCATALS GAGQLDSLDL  180
INGGDCCSKE GSSSFSSHSV EKIESGSESD KLTKELPQHH SSSHWKDCDE EDCFADIMKD  240
DIVKLDDSSY KERHNLLPIV TRKLESSTKS STQEFQDLMS HRLPFQGTAN RRLRLQTEIV  300
PRRVERSEVY EANKKNSRAV GTTRCLMINI IPIRRMKQWS IPLLLVFFAL LVIFLCLFGV  360
PQKVKWLRHL VVITPAEVNT RPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-44314622169NAC domain-containing protein 19
3swp_C4e-44314622169NAC domain-containing protein 19
3swp_B4e-44314622169NAC domain-containing protein 19
3swp_A4e-44314622169NAC domain-containing protein 19
3swm_D4e-44314622169NAC domain-containing protein 19
3swm_C4e-44314622169NAC domain-containing protein 19
3swm_B4e-44314622169NAC domain-containing protein 19
3swm_A4e-44314622169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787917.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1BQC90.0M1BQC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000504820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.18e-82NAC domain containing protein 60